PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G21880.1
Common NameBBX10, COL12, MEK6_2, MEK6.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 364aa    MW: 40470.4 Da    PI: 5.5546
Description B-box type zinc finger protein with CCT domain
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G21880.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.44.5e-06242339
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg....Htv 39
                 e+kC+++   ++ ++C+++   lC +C ++ H+     H++
  AT3G21880.1  2 EPKCDHCATSQALIYCKSDLAKLCLNCDVHVHSAnplsHRH 42
                 689*****988*********************668888765 PP

2CCT62.31.5e-21307350144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  R++a+lRYkeK+ +R F K+irY+sRKa+A++R+RvKGrFvk+ 
  AT3G21880.1 307 RNEAKLRYKEKKLKRSFGKQIRYASRKARADTRKRVKGRFVKAG 350
                  99***************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501198.66145IPR000315B-box-type zinc finger
SMARTSM003361.4E-5147IPR000315B-box-type zinc finger
CDDcd000211.94E-4335No hitNo description
PROSITE profilePS5101714.436307349IPR010402CCT domain
PfamPF062034.4E-16307349IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MEPKCDHCAT SQALIYCKSD LAKLCLNCDV HVHSANPLSH RHIRSLICEK CFSQPAAIRC  60
LDEKVSYCQG CHWHESNCSE LGHRVQSLNP FSGCPSPTDF NRMWSSILEP PVSGLLSPFV  120
GSFPLNDLNN TMFDTAYSMV PHNISYTQNF SDNLSFFSTE SKGYPDMVLK LEEGEEDLCE  180
GLNLDDAPLN FDVGDDIIGC SSEVHIEPDH TVPNCLLIDK TNTSSFTGSN FTVDKALEAS  240
PPGQQMNINT GLQLPLSPVL FGQIHPSLNI TGENNAADYQ DCGMSPGFIM SEAPWETNFE  300
VSCPQARNEA KLRYKEKKLK RSFGKQIRYA SRKARADTRK RVKGRFVKAG DSYDYDPSSP  360
TTNN
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184031820.0
Expression AtlasAT3G21880-
AtGenExpressAT3G21880-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G21880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G21880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936260.0AB493626.1 Arabidopsis thaliana At3g21880 mRNA for hypothetical protein, partial cds, clone: RAAt3g21880.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188826.10.0B-box type zinc finger protein with CCT domain
SwissprotQ9LJ440.0COL12_ARATH; Zinc finger protein CONSTANS-LIKE 12
TrEMBLD7L0Y00.0D7L0Y0_ARALL; Zinc finger (B-box type) family protein
STRINGAT3G21880.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53192240
Representative plantOGRP13751334
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Robson F, et al.
    Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
    Plant J., 2001. 28(6): p. 619-31
    [PMID:11851908]
  3. Griffiths S,Dunford RP,Coupland G,Laurie DA
    The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis.
    Plant Physiol., 2003. 131(4): p. 1855-67
    [PMID:12692345]
  4. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]